Recombinant Human CA13 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens carbonic anhydrase 13 (CA13) (NM_198584).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8N1Q1
Entry Name CAH13_HUMAN
Gene Names CA13
Alternative Gene Names
Alternative Protein Names Carbonic anhydrase 13 (EC 4.2.1.1) (Carbonate dehydratase XIII) (Carbonic anhydrase XIII) (CA-XIII)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 262
Molecular Weight(Da) 29443
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Background
Function FUNCTION: Reversible hydration of carbon dioxide.
Pathway
Protein Families Alpha-carbonic anhydrase family
Tissue Specificity Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis. {ECO:0000269|PubMed:14600151}.
QC Data
Please contact us for specific QC data.
$389.00
In stock
SKU
EB-EPE8230095

Recombinant Human CA13 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CA13 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.